PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00044.16
Common NameAMTR_s00044p00042560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 337aa    MW: 37646 Da    PI: 8.3861
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00044.16genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.32.9e-321971254
                                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                                             prlrWtpeLH++Fv+a+++LGG++kAtPk +l+lm+v gLt++hvkSHLQ+YR
  evm_27.model.AmTr_v1.0_scaffold00044.16 19 PRLRWTPELHHSFVHAIQKLGGQDKATPKLVLQLMDVRGLTISHVKSHLQMYR 71
                                             8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-301573IPR009057Homeodomain-like
PROSITE profilePS5129411.8961575IPR017930Myb domain
SuperFamilySSF466893.05E-151872IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-231971IPR006447Myb domain, plants
PfamPF002491.1E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGTCGRNGAV RQYIRSKIPR LRWTPELHHS FVHAIQKLGG QDKATPKLVL QLMDVRGLTI  60
SHVKSHLQMY RGMKSDSSRH ACHASQTSKY MEEEESSIIS SVKEVPTDFD SLSNVYHPLQ  120
PKGPADNYYV QMRDSMCGSS GACGGQKGMV GIDNSLAMAS SSSPSLYSAD NYSDETTMKQ  180
QHEAVIKGLL YTKMQRDGLD SLLTPHHRDI LKYNAQAASH FQDTELNHEH GPTRKRKFDP  240
KNDNRYDPFS SQFCKEWNRK EEEEVGDCTL SLSICPRSTK GYFTKSNASS NSENSEAASS  300
HSRLSFRGGT GRSSLEKNEI NLDLSISMYA TCRKQE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011627491.11e-152PREDICTED: uncharacterized protein LOC18445379
TrEMBLU5D6M50.0U5D6M5_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-34G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]